Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,831 – 1,845 of 1,806,628 results

1,831

Invitrogen™ degP Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Bacteria
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P0C0V0
Isotype	IgG
Concentration	5 mg/mL
Antigen	degP
Gene Symbols	degP
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	htrA; ptd
Gene	degP
Product Type	Antibody
Gene ID (Entrez)	75202024
Formulation	PBS with 50% glycerol and 0.03% Proclin 300; pH 7.4
Immunogen	Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP) (27-474AA).
Classification	Polyclonal
Primary or Secondary	Primary

1,832

Invitrogen™ LPS Monoclonal Antibody (C8)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Bacteria
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Western Blot
Form	Liquid
Isotype	IgG2b κ
Concentration	1 mg/mL
Antigen	LPS
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	LPS
Product Type	Antibody
Formulation	PBS with 50% glycerol and 0.05% ProClin 300; pH 7.4
Immunogen	Recombinant protein Lipopolysaccharide.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C8

1,833

Invitrogen™ FTSI Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Bacteria
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P0AD68
Isotype	IgG
Concentration	1.32 mg/mL
Antigen	FTSI
Gene Symbols	ftsI
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	pbpB
Gene	ftsI
Product Type	Antibody
Gene ID (Entrez)	75202099
Formulation	PBS with 50% glycerol and 0.03% Proclin 300; pH 7.4
Immunogen	Recombinant Escherichia coli (strain K12) FTSI protein.
Classification	Polyclonal
Primary or Secondary	Primary

1,834

Invitrogen™ Lipid A LPS Polyclonal Antibody

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Bacteria
Host Species	Goat
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunocytochemistry,Immunohistochemistry,Western Blot
Form	Liquid
Isotype	IgG
Concentration	5 mg/mL
Antigen	Lipid A LPS
Regulatory Status	RUO
Purification Method	IgG fraction
Gene Alias	Lipid A Lipopolysaccharide
Product Type	Antibody
Formulation	PBS with 0.1% sodium azide; pH 7.2
Immunogen	Whole cell prep of Lipid A from E. coli O157.
Classification	Polyclonal
Primary or Secondary	Primary

1,835

Invitrogen™ TPH2 Monoclonal Antibody (CL2990)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	Q8CGU9, Q8CGV2, Q8IWU9
Isotype	IgG1
Concentration	1 mg/mL
Antigen	TPH2
Gene Symbols	Tph2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ADHD7; AU043594; MGC119994; Neuronal tryptophan hydroxylase; NTPH; Tph2; TPRH; TRPH; Tryptophan 5-hydroxylase 2; tryptophan 5-monooxygenase 2; tryptophan hydroxylase 2
Gene	Tph2
Product Type	Antibody
Gene ID (Entrez)	121278, 216343, 317675
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein fragment of Human TPH2 (Product #RP-98454)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CL2990

1,836

Human gp96/HSP90B1 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Hamster,Human,Mouse,Rat,Virus
Host Species	Mouse
Conjugate	Unconjugated
Applications	Gene Knock-Out,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),Simple Western,Western Blot
Form	Purified
Isotype	IgG2a
Gene Accession No.	P14625
Concentration	LYOPH
Antigen	gp96/HSP90B1/GRP94
Gene Symbols	HSP90B1
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 0.2 ug/mL, Simple Western 2 ug/mL, Immunohistochemistry 8-25 ug/mL, Immunocytochemistry 8-25 ug/mL
Gene Alias	94 kDa glucose-regulated protein, ECGP, Endoplasmin, endothelial cell (HBMEC) glycoprotein, glucose regulated protein, 94 kDa, GP96ECGP, Grp94, GRP-94, GRP94gp96 homolog, Heat shock protein 90 kDa beta member 1, heat shock protein 90kDa beta (Grp94), member 1, HSP90B1, TRA1endoplasmin, tumor rejection antigen (gp96) 1, Tumor rejection antigen 1, Tumor rejection antigen-1 (gp96)
Gene ID (Entrez)	7184
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	E. coli-derived recombinant human gp96/HSP90B1 Arg503-Arg660 Accession # P14625
Classification	Monoclonal
Reconstitution	Sterile PBS to a final concentration of 0.5 mg/mL.
Primary or Secondary	Primary
Test Specificity	Detects human gp96/HSP90B1 in direct ELISAs and Western blots. Detects mouse and rat gp96/HSP90B1 in Western blots.
Clone	816803

1,837

Human/Mouse/Rat HSPA8/HSC71 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunohistochemistry,Simple Western,Western Blot
Form	Purified
Isotype	IgG3
Gene Accession No.	P11142
Concentration	LYOPH
Antigen	HSPA8/HSC71/Hsc70
Gene Symbols	HSPA8
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 0.1 ug/mL, Simple Western 1 ug/mL, Immunohistochemistry 5-25 ug/mL, Immunocytochemistry 8-25 ug/mL
Gene Alias	Heat shock 70 kDa protein 8, heat shock 70kD protein 8, heat shock 70kDa protein 8, heat shock cognate 71 kDa protein, heat shock cognate protein 54, heat shock cognate protein, 71-kDa, HSC54, HSC70, HSC70heat shock 70kd protein 10, HSC71, HSP71, HSP73, HSP73constitutive heat shock protein 70, HSPA10, LAP1, lipopolysaccharide-associated protein 1, LPS-associated protein 1, MGC131511, MGC29929, NIP71, N-myristoyltransferase inhibitor protein 71
Gene ID (Entrez)	3312
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	E. coli-derived recombinant human HSPA8 Asp534-Gly615 Accession # P11142
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human, mouse and rat HSPA8 in Western blots.
Clone	521503

1,838

CD25 Mouse anti-Human, BUV805, Clone: 2A3, BD Biosciences™

Mouse Monoclonal Antibody

Pricing & Availability

1,839

Carbonic Anhydrase IX/CA9 Antibody - BSA Free, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at -20C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Mouse,Plant,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Chemotaxis,ChIP Assay,Dual RNAScope ISH-IHC,ELISA,EMSA,Flow Cytometry,Gel Supershift,Immunoblot,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Microarray,Proximity Ligation Assay,Simple Western,Western Blot,Western Blot
Isotype	IgG
Gene Accession No.	Q16790
Research Discipline	Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction
Concentration	1.0 mg/mL
Antigen	Carbonic Anhydrase IX/CA9
Gene Symbols	CA9
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1 - 3 ug/ml, Simple Western 1:50, Flow Cytometry 1:1000, ELISA reported in scientific literature (PMID 19963243), Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 5 ug/ml, Immunoprecipitation 1:10 - 1:500. Use reported in multiple pieces of scientific literature, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen 1:200 - 1:500, Immunoblotting, Gel Super Shift Assays, Proximity Ligation Assay, Microarray reported in scientific literature (PMID 31955345), Chromatin Immunoprecipitation (ChIP) 1:10-1:500, Dual RNAscope ISH-IHC 1:1000
Molecular Weight of Antigen	55 kDa
Gene Alias	CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250
Product Type	Antibody
Gene ID (Entrez)	768
Formulation	PBS with 0.02% Sodium Azide
Classification	Polyclonal
Immunogen	A synthetic peptide made to a C-terminal sequence of human Carbonic Anhydrase IX (within residues 400-459) [UniProt Q16790]
Primary or Secondary	Primary
Test Specificity	Human, dog, rat and mouse (PMID 22842475).

1,840

NELL1 Antibody (6A8), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG2a κ
Gene Accession No.	NP_006148
Antigen	NELL1
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin
Gene Alias	FLJ45906, IDH3GL, nel (chicken)-like 1, NEL-like 1 (chicken), NEL-like protein 1, Nel-related protein 1, neural epidermal growth factor-like 1, NRP1, protein kinase C-binding protein NELL1
Gene ID (Entrez)	4745
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	NELL1 (NP_006148, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
Primary or Secondary	Primary
Clone	6A8

1,841

CD8a Rat anti-Mouse, APC-R700, Clone: 53-6.7, BD

Rat Monoclonal Antibody

Pricing & Availability

1,842

CD7 Mouse anti-Human, Unlabeled, Clone: M-T701, BD

Mouse Monoclonal Antibody

Pricing & Availability

1,843

CD25 Mouse anti-Human, BUV805, Clone: M-A251, BD Biosciences™

Mouse Monoclonal Antibody

Pricing & Availability

1,844

CD122 Mouse anti-Human, Brilliant Violet 786, Clone: Mik-β3, BD Optibuild™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	CD122
Regulatory Status	RUO
Content And Storage	Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Gene Alias	IL2RB, IL-2Rβ, IL-2R subunit beta, IL-2RB, IL15RB, IL-2/15Rb, IL-2R p75
Conjugate	Brilliant Violet 786
Target Species	Human
Host Species	Mouse
Formulation	Aqueous buffered solution containing ≤0.09% sodium azide.
Classification	Monoclonal
Immunogen	Human YTS Cell Line
Isotype	IgG1 κ
Primary or Secondary	Primary
Clone	Mik-β3

1,845

Invitrogen™ RS1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Pig
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	O15537
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	RS1
Gene Symbols	RS1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	retinoschisin; retinoschisin 1; retinoschisis (X-linked, juvenile) 1 (human); retinoschisis 1 homolog; RS; RS1; Rs1h; tmgc1; X-linked juvenile retinoschisis protein; X-linked juvenile retinoschisis protein homolog; XLRS1
Gene	RS1
Product Type	Antibody
Gene ID (Entrez)	106506914, 6247
Formulation	PBS with 50% glycerol and 0.05% ProClin 300; pH 7.4
Immunogen	Recombinant protein Retinoschisin. The antigen corresponds to amino acid range 24-224 of the target protein.
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ degP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ LPS Monoclonal Antibody (C8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FTSI Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Lipid A LPS Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TPH2 Monoclonal Antibody (CL2990) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human gp96/HSP90B1 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human/Mouse/Rat HSPA8/HSC71 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RS1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ degP Polyclonal Antibody

Invitrogen™ LPS Monoclonal Antibody (C8)

Invitrogen™ FTSI Polyclonal Antibody

Invitrogen™ Lipid A LPS Polyclonal Antibody

Invitrogen™ TPH2 Monoclonal Antibody (CL2990)

Human gp96/HSP90B1 Antibody, R&D Systems™

Human/Mouse/Rat HSPA8/HSC71 Antibody, R&D Systems™

Invitrogen™ RS1 Polyclonal Antibody